Items where Division is "FAKULTAS SENI DAN DESAIN" and Year is 2018

Up a level
Export as [feed] Atom [feed] RSS 1.0 [feed] RSS 2.0
Group by: Creators | Item Type | No Grouping
Jump to: A | B | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | W | Y | Z
Number of items: 226.

A

A. Nawis, Andi Jesria (2018) PENINGKATAN KETERAMPILAN BERNYANYI DENGAN PENERAPAN OLAH VOKAL DALAM KEGIATAN EKSTRAKURIKULER PADUAN SUARA PADA SISWA KELAS VII.A DI SMPN 3 MAIWA KABUPATEN ENREKANG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

AL QALBI, DIHYA (2018) KEBERADAAN MURAL PADA INTERIOR CAFE/ COFFEE SHOP DI KOMPLEKS PASAR SEGAR PANAKKUKANG MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

AMALIA, ANDI BATARI PUTRI (2018) STRUKTUR MANAJEMEN FANS CLUB MUSIK SULAWESI SELATAN. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

ASRIANTI, ASRIANTI (2018) UPAYA PENINGKATAN MINAT SISWA LAKI-LAKI DALAM MATA PELAJARAN PRAKTIK SENI TARI DI SMK 2 BARRU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

ASTIKA, ASTIKA (2018) PENGGUNAAN MEDIA AUDIO MIDI SEBAGAI UPAYA PENINGKATAN TEKNIK VOKAL DALAM MATERI BERNYANYI SECARA UNISONO SISWA KELAS VII.a SMP NEGERI 1 BANTAENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

ASTIKA.S, ASTIKA.S (2018) PENGGUNAAN MEDIA AUDIO MIDI SEBAGAI UPAYA PENINGKATAN TEKNIK VOKAL DALAM MATERI BERNYANYI SECARA UNISONO SISWA KELAS VII.a SMP NEGERI 1 BANTAENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

AZIS, SUARDI (2018) GENDRANG TELLUE DI DESA CABBENG KECAMATAN DUA BOCCOE KABUPATEN BONE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Abdillah, Reza (2018) Perancangan Novel Grafis Kisah Cinta Datu Museng dan Maipa Deapati. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Adawia, Rabiatul (2018) Perancangan Iklan Layanan Masyarakat Perlindungan dan Pencegahan Kekerasan Seksual pada Anak. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Adhlani, Muh. Risyaidil (2018) KEMAMPUAN MEWARNAI GAMBAR SISWA KELOMPOK A TK ANUGRAH AL ALIIMU KECAMATAN TAMALANREA MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Adrian, Alvin (2018) UPAYA MENINGKATAN KEMAMPUAN BERNYANYI MENGGUNAKAN METODE SIGHT READING PADA KELAS VIII SMP NEGERI 1 MAMASA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ahmad, Abd. Aziz (2018) Lomba Kaligrafi Islam Kontemporer: Salah Satu Alternatif Pengembangan Kaligrafi Islam. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. ISSN 978-602-5554-35-3 (In Press)

Ahmad S, Muhammad Ridwan (2018) KEMAMPUAN SISWA KELAS IX.1 SMPN 1 ANGGERAJA KABUPATEN ENREKANG DALAM PEMBUATAN KARYA MOSAIK MENGGUNAKAN BAHAN ALAM. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ain, Natasya Nur (2018) Perancangan Iklan Layanan Masyarakat Tentang Kebersihan Pasar Tradisional. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Aisah, Sitti (2018) PENDAPAT MAHASISWA PROGRAM STUDI PENDIDIKAN SENI RUPA TERHADAP PERANAN PPL DALAM PEMBENTUKKAN KOMPETENSI PROFESIONAL CALON GURU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ajeng, Tenri (2018) KARYA SENI LUKIS MIXED MEDIA (STUDI TERHADAP KARYA TIGA ORANG MAHASISWA PROGRAM STUDI PENDIDIKAN SENI RUPA FAKULTAS SENI DAN DESAIN UNIVERSITAS NEGERI MAKASSAR). S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Akbar, Dian (2018) PROSES PEMBUATAN TOTE BAG PADA USAHA MAKEASART DI KELURAHAN ROMANG POLONG KECAMATAN SOMBA OPU KABUPATEN GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Akbar, M. Zanuar (2018) PEMBUATAN KERAJINAN TANGAN H. M. YUNUS DARI TEMPURUNG KELAPA DI DESA RUPE KABUPATEN BIMA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Akmal, Muhammad Syafruddin (2018) KUALITAS KARYA SISWA DALAM KEGIATAN EKSTRAKURIKULER SENI KRIYA LOGAM DI SMP NEGERI 6 LABAKKANG LABSCHOOL UNM KABUPATEN PANGKEP. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Amalia, Andi Reski (2018) PELAKSANAAN PEMBELAJARAN MENGGAMBAR BENTUK DI KELAS X SMA NEGERI 3 SIDRAP KECAMATAN DUAPITUE KABUPATEN SIDRAP. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Amelia, Putri (2018) PENDEKATAN PLAY-BASED ACTIVITIES (BERMAIN SAMBIL BELAJAR) DALAM KEGIATAN EKSTRAKURIKULER TARI SEBAGAI UPAYA PENGEMBANGAN BAKAT DI SD TELKOM MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Amru, Muniruddin Ahmad (2018) PENGUASAAN MEDIA PENSIL WARNA DALAM MENGGAMBAR ILUSTRASI SISWA KELAS XII SMA NEGERI 1 TINAMBUNG KABUPATEN POLEWALI MANDAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Anas, Afdal (2018) PERANCANGAN ILUSTRASI ANIMASI SEJARAH TERBENTUKNYA ADDATUANG KERAJAAN SOPPENG. S1 thesis, Universitas Negeri Makassar.

Angraeni, Indri (2018) BENTUK DAN MAKNA SIMBOLIK RUMAH ADAT LANGKANAE LUWU DI KOTA PALOPO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Annishah, Nur (2018) PEMBELAJARAN TEATER DENGAN METODE DEMONSTRASI SEBAGAI UPAYA MENUMBUHKAN RASA PERCAYA DIRI PADA SISWA KELAS I SEKOLAH DASAR ISLAM ATHIRAH 2 MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Apriani, Fani (2018) PERSEPSI 50 ORANG MASYARAKAT KOTA PAREPARE TERHADAP MONUMEN PATUNG CINTA HABIBIE AINUN DALAM KAITANNYA DENGAN PENGEMBANGAN PARIWISATA KOTA PAREPARE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Aqilah, Aqilah (2018) Design Of Learning Media Of 3D Fruits Card For SLB Autis Bunda Perancangan Media Pembelajaran Kartu Buah-Buahan 3D Untuk SLB Autis Bunda. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Aqilah, Aqilah (2018) Perancangan Media Pembelajaran Kartu Buah-Buahan 3D Untuk SLB Autis Bunda. S1 thesis, Universitas Negeri Makassar.

Aqilah, Aqilah and Alimuddin, Alimuddin and Djirong, Agussalim (2018) Perancangan Media Pembelajaran Kartu Buah-Buahan 3D Untuk SLB Autis Bunda. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ardi, Ahmad fakhri (2018) Musik Sere Bissu dalam prosesi upacara adat Mattoriolo di Desa Goarie Kecamatan Marioriwawo Kabupaten Soppeng. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Asgan, Yudil (2018) SONGKO’ RECCA TO BONE: Potensi dan Permasalahannya. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Asis, Asrul (2018) Perbandingan Ketepatan Anatomi dan Proporsi pada Objek Gambar Antara Yang Dibuat Dengan Teknik Berskala (Grid) dan Yang Dibuat Dengan Teknik Bebas Oleh Kelas X2 dan X3 SMAN 1 Sinjai Selatan. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Asriadi, Asriadi (2018) Ketersediaan dan Kelayakan Koleksi Buku Perpustakaan Fakultas Seni dan Desain Universitas Negeri Makassar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Asriani, Sri (2018) KREATIVITAS SISWA KELAS IX A SMPN 1 BANGKALA MELALUI PEMBELAJARAN MAKRAME DENGAN MENGGUNAKAN TALI KUR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Aswar, Aswar (2018) MASYARAKAT STATUS DITENGAH IDENTITAS MAKASSAR SEBAGAI KOTA DAENG. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 81-85. ISSN 978-602-5554-35-3 (In Press)

Athmi, Nutfi (2018) Pakarena Turaya Pada Pesta adat Onto di Kelurahan Onto kabupaten Bantaeng Sulawesi Selatan. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Aziz, Baso Indra Wijaya (2018) PENINGKATAN KEMAMPUAN MAHASISWI DKV ANGK. 2015 MENGGUNAKAN KAMERA DIGITAL SECARA MANUAL. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 87-93. ISSN 978-602-5554-35-3 (In Press)

arif, Rahman (2018) KREATIVITAS MAHASISWA PENDIDIKAN SENI RUPA ANGKATAN 2015 DALAM MEMBUAT DESAIN BATIK. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

B

Baharuddin, Hikmawati (2018) Perancangan Ilustrasi Cerita Rakyat “Passaungan Tau” di Kabupaten Pangkep. S1 thesis, Fak. SENI DAN DESAIN.

Basri, Andi Hasan (2018) KEMAMPUAN SISWA KELAS X JURUSAN ADMINISTRASI PERKANTORAN DALAM MENGGAMBAR ILUSTRASI DENGAN MEDIA PENSIL WARNA DI SMK NEGERI 2 BELOPA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

D

DYAN MATANDUNG, LING (2018) MAKNA SIMBOLIK TARI PA’KATIA PADA UPACARA RAMBU SOLO’ DI KABUPATEN TORAJA UTARA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Daniel,, Andika (2018) GANDANG PADA UPACARA MA’PASONGLO PADA PESTA PEMAKAMAN RAHEL RAE’ PAEBONAN DI DESA ULUSALU KECAMATAN SALUPUTTI KABUPATEN TANA TORAJA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Darmadi., Darmadi. (2018) Perancangan Ilustrasi buku Panduan Tari Padduppa. S1 thesis, Universitas Negeri Makassar.

Darwis, Muh. (2018) PENGELOLAAN DAN PERAN AIMS BAND UNTUK MENARIK MINAT PENGUNJUNG TERHADAP CAFE LIVE MUSIK KAMPOENG POPSA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Dewi, Siska Monika (2018) PELAKSANAAN PEMBELAJARAN MENGGAMBAR ALAM BENDA PADA MATA PELAJARAN SENI BUDAYA KELAS VIII A DI SMP NEGERI 17 MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Diana,, Diana, (2018) STRATEGI PEMBELAJARAN MENGGAMBAR BUAH-BUHAN MELALUI METODE MENCONTOH PADA SISWA KELAS IV SD INPRES MANNURUKI I KOTA MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Djirong, Agussalim and Arifin, Irfan and T, Darmadi (2018) ILUSTRASI FOTOGRAFI DESAIN GERAKAN TARI PADDUPPA SEBAGAI BUKU PANDUAN PEMBELAJARAN. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 43-50. ISSN 978-602-5554-35-3 (In Press)

Dwiputri, Irfa Aulia (2018) EFEKTIVITAS PENERAPAN MEDIA WORD SQUARE BERBASIS KOOPERATIF TIPE STAD PADA MATA PELAJARAN SENI TARI KELAS VIII SMPN 3 POLEWALI. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

E

Edy T, Ronal (2018) Perancangan Brand Identity Jalangkote Lahalede. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Edy T, Ronal (2018) Perancangan Brand Identity Jalangkote Lahalede. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ekasari, Dian (2018) MUSIK PATROL PADA MALAM MAPPACCI DESA SEMPANG TIMUR KABUPATEN PINRANG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Enggaresty, Octa (2018) PEMBELAJARAN SENI RUPA TERAPAN DARI BAHAN BEKASPADA SISWA KELAS XI SMA NEGERI 4 WAJO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

F

FANIDA, NURUL (2018) TARI MPA’A LANCA PADA UPACARA PENYAMBUTAN TAMU DI DESA SAMBORI KABUPATEN BIA NUSA TENGGARA BARAT. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

FEBRINA H, ILLIYYUN (2018) TARI LUMONDO SEBAGAI TARI PENYAMBUTAN TAMU RESMI PEMERINTAH DAERAH LUWU UTARA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

FITRA, PADIL (2018) MUSIK IRINGAN TARI KREASI PAKARENA MA’LINO KARYA BASRI B. SILA DI SANGGAR SENI BATARA GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Faldi, Andi (2018) PERANCANGAN PANDUAN WISATA PANTAI KABUPATEN BULUKUMBA. S1 thesis, Universitas Negeri Makassar.

Faldi, Andi (2018) PERANCANGAN PANDUAN WISATA PANTAI KABUPATEN BULUKUMBA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Fauzi, Hizbi (2018) Simbolisme Pada Upacara Pencucian Alat Pusaka Pada Acara Accerak Kalompoang di Rumah Adat Balla Lompoa Kabupaten Gowa. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Febriani Arman,, Arfani (2018) TARI SILONRENG PADA ACARA ATTARALU DI KECAMATAN BENTENG KABUPATEN KEPULAUAN SELAYAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Febrianti, Putri (2018) KEMAMPUAN CALON MAHASISWA BARU PROGRAM STUDI PENDIDIKAN SENI RUPA FAKULTAS SENI DAN DESAIN UNIVERSITAS NEGERI MAKASSAR DALAM MENGGAMBAR EKSPRESI. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Firman, Firman (2018) Menggambar Ilustrasi Tumbuhan Menggunakan Bolpoin Mahasiswa Semester I Program Studi Pendidikan Seni Rupa Fakultas Seni dan Desain Universitas Negeri Makassar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Fitria, Rizki (2018) OPINI MAHASISWA PROGRAM STUDI PENDIDIKAN SENI RUPA TERHADAP PELAKSANAAN KKN PPL TERPADU UNIVERSITAS NEGERI MAKASSAR ANGKATAN XV TAHUN 2017. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Fitriana K, Vivi (2018) KESESUAIAN ANTARA MATERI PEMBELAJARAN DENGAN KOMPETENSI DASAR DAN INDIKATOR PENCAPAIAN DALAM RENCANA PELAKSANAAN PEMBELAJARAN SENI BUDAYA (SENI RUPA) KELAS VIII SMP NEGERI 1 TANETE RIAJA KABUPATEN BARRU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Fitriani, Nur (2018) The Illustration Book Design of Pemali (Kapalli’ ) Culture in Selayar Perancangan Buku Ilustrasi Budaya Pemali (Kapalli’) di Selayar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Fitriani, Nur (2018) Perancangan Buku Ilustrasi Budaya Pemali (Kapalli’) di Selayar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Fransiska Utler, Thersila Tasia (2018) Design of Tourism Promotion Media in Jayapura District Perancangan Media Promosi Pariwisata di Kabupaten Jayapura. S1 thesis, Fak. SENI DAN DESAIN.

G

Gaffar, Nurfidari (2018) PENERAPAN KELAS OUTDOOR PADA MATERI VOKAL UNISONO UNTUK MENINGKATKAN MINAT BELAJAR SISWA KELAS VIIIB SMP NEGERI 1 PAMBOANG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Givari, Ananda Al (2018) PERANCANGAN GAMBAR ILUSTRASI DONGENG NENEK PAKANDE DENGAN TEKNIK PAPER CUT. S1 thesis, Universitas Negeri Makassar.

H

HAERUDDDIN, HAERUDDDIN (2018) PROSES PEMBUATAN GITAR AKUSTIK PRODUKSI HARMONI GITAR MAKASSAR ( TINJAUAN ORGANOLOGI ). S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

HANI, ABDUL HAMSA (2018) Persepsi Mahasiswa Program Studi Pendidikan Seni Rupa Fakultas Seni dan Desain Universitas Negeri Makassar terhadap Studi Khusus Fotografi. S1 thesis, FSD.

HARIANTO, SUPARDI (2018) Penerapan Metode Drill dalam pembelajaran seni Musik(Vokal) untuk Meningkatkan Teknik Penguasaan lagu daerah setempat pada Siswa Kelas VIII SMPN 27 Makassar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

HENDRA, HENDRA (2018) BENTUK PENYAJIAN GENRANG BAJO OLEH KELOMPOK SENI ANGNGARUA KECAMATAN TANETE RIATTANG TIMUR KABUPATEN BONE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hadrika, Siti (2018) Perancangan Media Kampanye Sosial Peningkatan Motivasi Guru Dalam Mengajar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hadrika, Siti (2018) Perancangan Media Kampanye Sosial Peningkatan Motivasi Guru Dalam Mengajar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Haeril, Haeril (2018) KARAKTERISTIK KARYA ILUSTRASI KOMUNITAS “PENAHITAM” MAKASSAR PROCESS OF MAKING PAPER SCULPTURE BY COMMUNITY "STRAIGHT LINE" MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hakim, Umarul (2018) KEMAMPUAN MENGGAMBAR BEBAS SISWA TUNARUNGU SLB/B NEGERI 1 MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hamriyadi, Hamriyadi (2018) Fungsi Penyajian Gendang Makassar dalam Prosesi Pencucian Benda Pusaka pada Upacara Adat Gaukang di Galesong Kabupaten Takalar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hardiyanti, Yariska (2018) The Design Of Color Recognition Media For Early Childhood Perancangan Media Pengenalan Warna Untuk Anak Usia Dini. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hardiyanti, Yariska (2018) The Design Of Color Recognition Media For Early Childhood Perancangan Media Pengenalan Warna Untuk Anak Usia Dini. S1 thesis, Fak. SENI DAN DESAIN.

Hariadi, Ganis (2018) TINJAUAN TERHADAP HASIL BELAJAR MAHASISWA ANGKATAN 2016 PROGRAM STUDI PENDIDIKAN SENI RUPA FAKULTAS SENI DAN DESAIN UNIVERSITAS NEGERI MAKASSAR PADA MATA KULIAH SENI LUKIS II. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hasan, Hasan (2018) Perancangan Kemasan Lomo’ Mandar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hasan, Hasan (2018) Perancangan Kemasan Lomo’ Mandar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hasan, Munawir (2018) Perancangan Katalog Kuliner Khas Kota Makassar. S1 thesis, Universitas Negeri Makassar.

Hasanuddin, Hasanuddin (2018) KREASI BONEKA UNTUK DEKORASI DARI BAHAN STYROFOAM PRODUKSI STUDIO KUKANA PRODUCTION. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hasnawati, Hasnawati and M., Yabu and Yunus, Pangeran Paita (2018) PENTINGNYA INSTRUMEN PENILAIAN UNTUK KARYA SENI RUPA. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 117-123. ISSN 978-602-5554-35-3 (In Press)

Hasruni, Hasruni (2018) The Infographic Video Design Of The Prayer Movement For Children Perancangan Video Infografis Gerakan Shalat Untuk Anak-Anak. S1 thesis, FSD.

Hasruni, Hasruni (2018) Perancangan Video Infografis Gerakan Shalat Untuk Anak-Anak. S1 thesis, Universitas Negeri Makassar.

Hikmah, Nurul (2018) Makassar City Tour Guide Design Perancangan Panduan Wisata Kota Makassar. S1 thesis, Fak. SENI DAN DESAIN.

Hikmah, Nurul (2018) Makassar City Tour Guide Design Perancangan Panduan Wisata Kota Makassar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Hikmah, Nurul (2018) Makassar City Tour Guide Design Perancangan Panduan Wisata Kota Makassar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

I

IRSANDI, IRSANDI (2018) GANDRANG TALLUA DI KAMPUNG ALLU KECAMATAN BANTAENG KABUPATEN BANTAENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ihsan, Andi and Jayadi, Karta (2018) Kitoka : an Alternative of Traditional String Instrument Instruction. The Journal of Educational Development, 6 (3). pp. 341-347. ISSN 2085-4943 (Submitted)

Ikhsan, Muhammad (2018) BENTUK PENYAJIAN GRUP ORKES SONATA PADA ACARA PERNIKAHAN DI KABUPATEN GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ikrar, Ikrar (2018) PROSES PEMBUATAN PATUNG KERTAS OLEH KOMUNITAS“ GARIS LURUS ” MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Indriana S, Indriana S (2018) MINAT SISWA MTS ASSALAMIYAH GALESONG KABUPATEN TAKALARTERHADAP EKSTRAKURIKULER SENI KALIGRAFI ISLAM. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Iqrawati, Iqrawati (2018) PROSES PEMBUATAN ANYAMAN TEPAK OLEH PERAJIN DI DESA DATARA KECAMATAN TOMPOBULU KABUPATEN GOWA. S1 thesis, Universitas Negeri Makassar.

Irfan, Ade (2018) The Design of Drawing Learning Books Coloring Historical Objects in South Sulawesi Perancangan Buku Pembelajaran Menggambar Mewarnai Objek Bersejarah di Sulawesi Selatan. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Irfan, Ade (2018) Perancangan Buku Pembelajaran Menggambar Mewarnai Objek Bersejarah di Sulawesi Selatan. S1 thesis, Universitas Negeri Makassar.

Irfan, Ade (2018) Perancangan Buku Pembelajaran Menggambar Mewarnai Objek Bersejarah di Sulawesi Selatan. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Irfan, Irfan (2018) KEMAMPUAN MELUKIS DENGAN MEDIA PASTEL SISWA KELAS X SMA NEGERI 2 MAJENE KABUPATEN MAJENE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Irfan, Irfan (2018) KEMAMPUAN MELUKIS DENGAN MEDIA PASTEL SISWA KELAS X SMA NEGERI 2 MAJENE KABUPATEN MAJENE ABILITY TO PAINT WITH MEDIA PASTEL CLASS X STUDENT OF STATE HIGH SCHOOL 2 MAJENE DISTRICT MAJENE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Irmawati, Irmawati (2018) PROSES PEMBELAJARAN SENI KRIYA DARI LIMBAH BOTOL PLASTIK BAGI SISWA KELAS X1 SMK BAJIMINASA MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Irmawati, Irmawati (2018) PROSES PEMBELAJARAN SENI KRIYA DARI LIMBAH BOTOL PLASTIK BAGI SISWA KELAS X1 SMK BAJIMINASA MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Irwan, Irwan and Jayadi, Karta and Yunus, Pangeran Paita (2018) Evaluasi Pelaksanaan Penilaian Autentik (Aspek Psikomotorik) Dalam Pembelajaran Berkarya Seni Rupa Dua Dimensi (Studi Pada Sekolah Menengah Atas Di Kecamatan Patallassang Kabupaten Takalar). Jurnal Nuansa, 1 (2). pp. 70-79. ISSN 2597-4041, 2597-405X

J

Jasmail, Muhammad Saddam (2018) PERANCANGAN TUTORIAL BAJU KAOS SECARA MANUAL. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Jayadi, Karta (2018) ARTS AS ENTREPRENEURSHIP AND ECONOMIC CAPITAL IN TANA TORAJA, INDONESIA. Journal of Entrepreneurship Education, 21 (3). pp. 1-10. ISSN 1528-2651

Jayadi, Karta (2018) Functions and Types of Tau-Tau Statue as Torajan Identity in South Sulawesi Indonesia. Journal of Arts & Humanities, 7 (9). pp. 9-13. ISSN 2167-9045, 2167-9053

K

KHAERI, UMMUL (2018) PENINGKATAN KEMAMPUAN MENARI TARI PAJAGA ANDI DALAM PEMBELAJARAN SENI BUDAYA DENGAN METODE PERAGAAN PADA SISWA KELAS X SMAN 14 BONE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Kadir, Kasma (2018) KEMAMPUAN MENGAPRESIASI KARYA SENI RUPA DAERAH SETEMPAT SISWA KELAS XI SMK NEGERI 3 GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Kaharuddin, Kaharuddin (2018) PROSES PEMBUATAN SULING LAMPE PRODUKSI RAPPE DI DESA BARAMBANG KECAMATAN SINJAI BORONG KABUPATEN SINJAI (SEBUAH TINJAUAN ORGANOLOGIS). S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Katu, Mardhathillah Ayu (2018) PEMBELAJARAN KERAJINAN TANGAN DARI BAHAN CLAY TEPUNG BAGI SISWA KELAS VIII SMPN 3 ANGGERAJA KABUPATEN ENREKANG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Khabir, Muhammad (2018) PERANCANGNA MEDIA PEMBELAJARAN SENI UKIR KAYU BERBASIS SOFTWARE MICROSOFT POWERPOINT UNTUK SISWA SMK NEGERI 2 PALOPO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Khaerunnisa, Andi (2018) KREATIVITAS SISWA DALAM MEMBUAT KARYA SENI DARI KERTAS DENGAN TEKNIK PAPER QUILLING DI SMP NEGERI 2 MAJAULENG KABUPATEN WAJO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Kumalasari, Rezky (2018) PERANCANGAN PELATIHAN TEKNIK OLAH DASAR TEATER MELALUI KEGIATAN EKSTRAKURIKULER DI SMA NEGERI 4 BARRU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Kumalasari, Rezky (2018) Perancangan Pembelajaran Teknik Olah Dasar Teater pada Kegiatan Ekstrakurikuler di SMA Negeri 4 Barru. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Kusumawati, Hilda Jayanti (2018) Desain Media Pembelajaran Teknik Dasar Cat Air dalam Mata Pelajaran Seni Rupa. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

L

LINA, FEBRIYANTI (2018) MUSIK PA’BIOLA GRUP SIPAKARIO DI KECAMATAN SABBANGPARU KABUPATEN WAJO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Langngan, Reski Rante (2018) PROSES PEMBUATAN UKIRAN HIASAN DINDIN DI DESA TONGA KECAMATAN KESU’ KABUPATEN TORAJA UTARA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Lestari, Anggi (2018) PERTUNJUKAN TARI LUMINDA PADA ACARA PESTA RAKYAT DESA WOSU KECAMATAN BUNGKU BARAT KABUPATEN MOROWALI SULAWESI TENGAH. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Lestari, Rizky (2018) TARI MORIRINGGO PADA ACARA PENYAMBUTAN TAMU PEMERINTAHAN DI KABUPATEN LUWU TIMUR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Lisnawati, Lisnawati (2018) PENINGKATAN HASIL BELAJAR SENI TARI MELALUI MODEL PEMBELAJARAN KOOPERATIF TIPE MIND MAPPING PADA SISWA KELAS VII.A DI SMP NEGERI 2 MARIORIWAWO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

M

M., Rahma (2018) KEMAMPUAN BERFIKIR KRITIS PADA PROSES PENGGARAPAN KONSEP KARYA TARI MAHASISWA PRODI SENI TARI FSD UNM. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 297-306. ISSN 978-602-5554-35-3 (In Press)

MAPPALAHERE, MOH. THAMRIN (2018) MASYARAKAT DAN SENI LUKIS (SUATU KAJIAN SOSIOLOGI SENI MAKNA ESTETIS SENI LUKIS DALAM INTERAKSI SOSIAL BUDAYA MASYARAKAT KOTA MAKASSAR). Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 179-190. ISSN 978-602-5554-35-3 (In Press)

MARSUKI, MARSUKI and SUWARDI, SUWARI and HAKIM, HIKMAD (2018) PENGARUH KECEPATAN REAKSI KAKI, DAYA LEDAK TUNGKAI, DAN MOTIVASI BELAJAR TERHADAP KEMAMPUAN LOMPAT JAUH SISWA SMP NEGERI 1 CINA KABUPATEN BONE. S2 thesis, UNIVERSITAS NEGERI MAKASSAR.

MAULYAHRUNI,, LISDA (2018) PENINGKATAN KETERAMPILAN SENI TARI MELALUI PENDEKATAN PEMBELAJARAN KONTEKSTUAL SISWA SMA NEGERI 2 PALOPO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Maddo, Difa Giofani (2018) KEMAMPUAN SISWA KELAS XI PROGRAM KEAHLIAN KRIYA KERAMIK SMK NEGERI 3 GOWA DALAM PEMBELAJARAN DEKORASI KERAMIK TEKNIK TEMPEL DAN TEKNIK UKIR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Mahmud, Rudini (2018) KECAPI MANDAR TOBAINE DI KECAMATAN BALANIPA KABUPATEN POLEWALI MANDAR(Suatu Kajian Organologi). S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Makkasau. F, Pinandita A. (2018) Pembelajaran Kegiatan Ekstrakurikuler Seni Lukis Cat Air Pada Siswa SMA Negeri 3 Palopo. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Marante, Rince Tumba (2018) FUNGSI DAN MAKNA SIMBOLIK MOTIF KAIN TENUN TRADISIONAL TORAJA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Melisa, Irna (2018) Laporan Proyek Akhir “Perancangan Logo Celebes Canyon Barru“. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Melisa, Irna (2018) Perancangan Logo Celebes Canyon Barru. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Melisa, Irna (2018) Perancangan Logo Celebes Canyon Barru. S1 thesis, Universitas Negeri Makassar.

Muannassafathurrahman, Muannassafathurrahman (2018) SYARAT PERKAWINAN DAN JIKI HADRA PADA PROSESI MADA RAWI DALAM UPACARA PERKAWINAN MASYARAKAT BIMA NUSA TENGGARA BARAT. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Muhdar, Muhdar (2018) KEGIATAN EKSTRAKURIKULER UNTUK PENGEMBANGAN BAKAT MINAT BERMAIN GITAR DI SMAN 2 PANGKAJENE KAB.PANGKEP. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Muliadi, Muliadi (2018) BENTUK TARI PAKARENA MARE-MARE DI DESA MARE-MARE KECAMATAN BONTOMANAI KABUPATEN KEPULAUAN SELAYAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Muminin, Amirul (2018) PERANCANGAN GAME BUDAYA SULAWESI TENGGARA PETUALANGAN HALUOLEO. S1 thesis, Universitas Negeri Makassar.

Musafir, Ahmad (2018) Perancangan Buku Esai Fotografi Human Interest Pada Adat Pernikahaan Suku. S1 thesis, Universitas Negeri Makassar.

Musafir, Ahmad (2018) Perancangan Buku Esai Fotografi Human InterestPada Adat Pernikahaan Suku. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Mushaydir, Andi Muchdar (2018) Peningkatan Hasil Belajar Seni Budaya Ekstrakurikuler Seni Lukis Cat Minyak Pada Siswa Kelas XI IPA SMA Negeri 11 Bulukumba. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Muslimin, Inam (2018) Perancangan Ilustrasi Cerita Rakyat “Passaungan Tau” di Kabupaten Pangkep. S1 thesis, Universitas Negeri Makassar.

Mustang, Ainum (2018) NILAI ESTETIK TARI LINDA DI KECAMATAN BETOAMBARI KELURAHAN LIPU KOTA BAU BAU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Mutmainnah, Mutmainnah (2018) KARAKTERISTIK GAMBAR BEBAS SISWA KELAS IV DAN KELAS IV SD NEGERI PARANGTAMBUNG 1. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

mantariah, Hanna (2018) ABILITY TO MAKE ORIGAMI CRAFTS IN EARLY CHILDREN KIDS OF ISLAMIC CHILDREN MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

musdalifah, Endang (2018) MAKNA PERTUNJUKAN TARI SUMAJO PADA PESTA PERNIKAHAN DI DESA MAIPI KECAMATAN MASAMBA KABUPATEN LUWU UTARA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

N

N. FITRIYANI,, AMANDA (2018) EKSITENSI TARI PAJAGA BONE BALLA (SULESSANA) DI KEDATUAN LUWU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

NAWIR, NAWIR (2018) STRUKTUR GANRANG PAMANCA’ PADA MASYARAKAT KABUPATEN JENEPONTO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

NIRWANA, NIRWANA (2018) SANGGAR MADDIKA BUA SEBAGAI SALAH SATU WADAH PELESTARIAN TARI PAJAGA LILI DI KABUPATEN LUWU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

NUR ADNAN SANDI,, MUHAMMAD (2018) PERTUNJUKAN MANCA’ KANREJAWA PADA PROSESI MALAM KORONTIGI DI DESA TAENG KECAMATAN PALLANGGA KABUPATEN GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

NURZAM, ABDUL RAZAK (2018) PROSES PEMBUATAN ALAT MUSIK CELLO PETIK PRODUKSI HAMBALI DI KELURAHAN TOMBOLO KECAMATAN SOMBAOPU KABUPATEN GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Nashrullah, A.Muh. (2018) KEMAMPUAN MENCETAK CUKIL KAYU PADA MAHASISWA PROGRAM STUDI PENDIDIKAN SENI RUPA ANGKATAN 2014 FAKULTAS SENI DAN DESAIN UNIVERSITAS NEGERI MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Natsir, Muhammad Azwar (2018) Perancangan Ilustrasi Untuk Melestarikan Permainan Tradisional Di Kota Makassar. S1 thesis, Universitas Negeri Makassar.

Nengsih, Riska Ayu (2018) UNSUR INTRINSIK DALAM NOVEL GITNJALI KARYA FEBRIALDI R BERDASARKAN TEORI STRUKTURAL ROBERT STANTON. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Nugraha, Ahmad Ade (2018) SIMBOLISME SARUNG SUTERA WAJO. S1 thesis, Universitas Negeri Makassar.

Nugraha, Ahmad Ade (2018) SIMBOLISME SARUNG SUTERA WAJO. S1 thesis, Universitas Negeri Makassar.

Nugraha, Ahmad Ade (2018) SIMBOLISME SARUNG SUTERA WAJO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Nur, A. Arjuna (2018) MITOS DALAM LUKISAN KARYA MOH. THAMRIN MAPPALAHERE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Nur Dp, Rahmi Damayanti (2018) KOREOGRAFI SEBAGAI SARANA PEMBELAJARAN KREATIVITAS DI SMA NEGERI 13 BONE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Nurabdiansyah, Nurabdiansyah (2018) PENCIPTAAN BRANDING BARU LABORATORIUM KEWIRAUSAHAAN DAN KREATIFITAS MAHASISWA MELALUI GALERI SENI SANDEQ LA MACCA UNM. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 233-242. ISSN 978-602-5554-35-3 (In Press)

Nurfadilah.S, Nurfadilah.S (2018) KEMAMPUAN BERKARYA SENI RUPA TIGA DIMENSI DENGAN MEDIA SABUN SISWA KELAS XI IPA 1 MADRASAH ALIYAH NEGERI 3 BONE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

O

Oktafianingsih, Oktafianingsih (2018) ANALISIS TERHADAP GAMBAR ANAK USIA DINI DI TK PEMBINA DESA RATO KECAMATAN LAMBU KABUPATEN BIMA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

P

PURNAMASARI, EKA REZKI (2018) BISSU PADA MASYARAKAT BUGIS SOPPENG MASA KINI. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Padang, Siti Sakinah Nurmina Tenri (2018) Design Of Educational Media Introduction The Lontara Script Of Makassar For The Age Of 6-8 Years. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Padang, Siti Sakinah Nurmina Tenri (2018) Perancangan Media Edukasi Pengenalan Aksara Lontara Makassar Untuk Usia 6-8 Tahun. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Pratiwi, Cita Anggun (2018) Mural dI Lorong Mannuruki IV Kelurahan Mannuruki Kecamatan Tamalate. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Prusdianto, Prusdianto (2018) PENDIDIKAN SENI TEATER; SEKOLAH, TEATER DAN PENDIDIKNYA. Tanra, 5 (1). pp. 30-39. ISSN 2407 – 6066

Prusdianto, Prusdianto and Rahmaeni, Andi and Mukminin, Rahmatullah and Sain, Muhammad Erwin and Kasin, Besse Ayu Wulandari (2018) PEMBELAJARAN PANTOMIM KEPADA TUNARUNGU SEBAGAI SOLUSI KOMUNIKATIF TERHADAP ANAK DENGAR. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 287-295. ISSN 978-602-5554-35-3 (In Press)

Putra, Ari (2018) Packaging Design Canggoreng Sa’ma Polewali Mandar Perancangan Kemasan Canggoreng Sa’ma Polewali Mandar. S1 thesis, Universitas Negeri Makassar.

Putri, Desty Sri (2018) Pembuatan Media Pembelajaran Tarian TamborinBerbasis Audio Visual untuk Remaja. S1 thesis, UNIVERSITAS NEGERI MAKKASAR.

Putri, Desty Sri (2018) Pembuatan Media Pembelajaran Tarian TamborinBerbasis Audio Visual untuk Remaja. S1 thesis, Universitas Negeri Makassar.

Putri, Desty Sri (2018) Pembuatan Media Pembelajaran Tarian TamborinBerbasis Audio Visual untuk Remaja. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Q

QADRIAH, ASNI (2018) KREATIVITAS SISWA DALAM PENGOLAHAN LIMBAH PLASTIK MENJADI KARYA SENI (Studi terhadap Kelompok Organisasi Sekolah Adiwiyata pada SMA 2 Enrekang). S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

R

RAHMI, NUR (2018) PENINGKATAN MINAT SISWA LAKI-LAKI PADA PEMBELAJARAN SENI TARI DENGAN METODE TUTOR SEBAYA PADA KELAS VIII B DI SMP NEGERI 2 BANTAENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rahayu, Mustika (2018) UPAYA MENINGKATKAN MINAT SISWA LAKI-LAKI TERHADAP PEMBELAJARAN SENI TARI MELALUI TARI MA’RANDING DENGAN METODE PEMBELAJARAN DIRECT DI KELAS X SMAN 1 KELARA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rahman, Abdul (2018) PEMBELAJARAN SENI KRIYA DARI BAHAN DASAR TEMPURUNG KELAPA BAGI SISWA KELAS XI SMA NEGERI 1 LAROMPONG KABUPATEN LUWU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rahmat, Rahmat (2018) KREATIVITAS MAHASISWA PENDIDIKAN SENI RUPA FSD UNM DALAM MENGEMBANGKAN KOMPOSISI GARIS PADA MATA KULIAH DASAR DESAIN DWIMATRA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Raihan Marzuq, Muh. (2018) PEMBELAJARAN SENI TEATER SEBAGAI UPAYA PENINGKATAN MINAT BELAJAR TEATER MENGGUNAKAN METODE RESITASI PADA SISWA KELAS VIII DI SMP TAMAN YAYASAN UJUNG PANDANG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rasidi, Ahmad (2018) KEMAMPUAN MENGGAMBAR MOTIF BATIK TEKNIK POINTILIS OLEH SISWA KELAS X DI SMA NEGERI 9 GOWA CAPABILITIES ABOUT MOTIF BATIK POINTILIS ENGINEERING BY CLASS X STUDENTS IN SMA NEGERI 9 GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rezaldi, Ahmad (2018) PROSES PEMBUATAN TENNONG – TENNONG SEBAGAI UPAYA PELESTARIAN ALAT MUSIK TRADISIONAL DI KABUPATEN PANGKAJENE DAN KEPULAUAN. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rezky, Sri Novita (2018) PEMBELAJARAN EAR TRAINING UNTUK MENINGKATKAN KEMAMPUAN BERNYANYI PADA KELOMPOK PADUAN SUARA (EKSTRAKURIKULER) DI MAN 1 SINJAI UTARA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ririn, Ririn (2018) PELAKSANAAN PEMBELAJARAN PRAKARYA PADA KELAS VIII SMP NEGERI 19 BULUKUMBA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rizky, Nuzul (2018) PERSEPSI MAHASISWA TERHADAP PELAKSANAAN STUDI KHUSUS PROGRAM STUDI PENDIDIKAN SENI RUPA FAKULTAS SENI DAN DESAIN UNIVERSITAS NEGERI MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Rosmini, Rosmini (2018) BENTUK DAN MAKNA SIMBOLIS MOTIF SARUNG TENUN SONGKET KHAS SUKU BIMA NUSA TENGGARA BARAT. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Ruslin, Ruslin (2018) KEMAMPUAN MEWARNAI GAMBAR MENGGUNAKAN KRAYON BAGI MURID TAMAN KANAK-KANAK AL ABRAR DESA KANANGA KECAMATAN BOLO KABUPATEN BIMA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

S

SATRIAWATY, SATRIAWATY (2018) COOPERATIVE LEARNING PADA LAGU INDONESIA RAYA DAN LAGU MENGHENINGKAN CIPTA DALAM KEGIATAN EKTRAKURKULER DI SMA NEGERI 5 TAKALAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

SIGARA, RANI (2018) PELATIHAN MUSIK PADA SANGGAR SENI TUMABUTTAYA RI BANTAYAN SEBAGAI BENTUK PENGEMBANGAN MINAT BAKAT SISWA SMK NEGERI 3 BANTAENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

SUHARTINI, TITIN (2018) SANGGAR SENI SEKOLAH SEBAGAI WADAH PENGEMBANGAN MINAT TARI TERHADAP SISWA SMP NEGERI 26 MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

SURYANI, IRMA (2018) PEMERANAN JAMILAH DALAM PERTUNJUKAN TEATER JAMILAH SANGGAR SENI SYEKH YUSUF KABUPATEN GOWA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Salam, Sofyan (2018) POTENSI UNIK PENDIDIKAN SENI DALAM PENGEMBANGAN KARAKTER. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 21-34. ISSN 978-602-5554-35-3 (In Press)

Salenu, Fransiska Sinar (2018) RANCANGAN PEMBELAJARAN BERBASIS ANGKA DI KELAS V SEKOLAH DASAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Sandi, Andi Windra (2018) MAKNA YANG TERKANDUNG DALAM KARYA KALIGRAFI ISLAM KONTEMPORER ABD. AZIZ AHMAD. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Sangaji, Novrizal (2018) ANALISIS BENTUK DASAR GAMBAR ANAK DALAM FASE CORENG-MORENG PADA PENDIDIKAN ANAK USIA DINI DI TIM PENGELOLA KEGIATAN (TPK) AL-AQSAN DESA TONRONG RIJANG KABUPATEN SIDRAP. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Sephiyang, Herdiana (2018) BENTUK DAN SISTEM KERJA ARTIST IN RESIDENCY SEBAGAI PROGRAM PELATIHAN TEATER DI RUMATA ARTSPACE. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Septiani, Rizky (2018) PerancanganMedia Pembelajaran Membaca Permulaan Untuk Siswa Sekolah Dasar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Setiawan, Teguh (2018) TARI MPA’A NTUMBU TUTA PADA PROSESI PERNIKAHAN MASYARAKAT DESA NTORI BIMA NUSATENGGARA BARAT. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Soraya, Hilma (2018) KOMPARASI TARI EMPAT ETNIS SANGGAR FRIDA MAKASSAR DENGAN TARI KALOMPOANNA PARASANGANTA PRODUKSI YAYASAN ANGING MAMMIRI DI MAKASSAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Suaedy, Nurdyanti (2018) CHARACTERISTICS OF MATHEMATICAL REASONING IN SOLVING MATHEMATICAL PROBLEMS IN TERMS OF THE COGNITIVE STYLE OF THE ELEVENTH GRADE STUDENTS OF SMA NEGERI 3 WAJO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Sukmawati, Sukmawati (2018) KEBERADAAN SANGGAR SENI COLLIQ PUJIE DALAM UPAYA MENGEMBANGKAN SENI PERTUNJUKAN DI KABUPATEN BARRU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Sulastri, Ika (2018) PELATIHAN CHOIR FOLKLORE DALAM RANGKA PERSIAPAN PENTAS SISWA MELALUI EKSTRAKURIKULER DI SMA NEGERI 20 BONE IKA SULASTRI. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Sumiani, Sumiani (2018) KEMAMPUAN MAHASISWA MENGEMBANGKAN MOTIF GERAK DALAM PROSES KOREOGRAFI PADA MATA KULIAH TARI PENDIDIKAN II DI PROGRAM STUDI PENDIDIKAN SENDRATASIK FSD UNM. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 347-357. ISSN 978-602-5554-35-3 (In Press)

Suwito, Frengki (2018) SARUNG TENUN LIPA’ SO’BI’ DI TANJUNG BIRA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Syakhruni, Syakhruni (2018) PENGEMBANGAN MATERI PEMBELAJARAN SENI TARI BERBASIS SENI BUDAYA BAGI SISWA SMA DI MAKASSAR. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. pp. 371-382. ISSN 978-602-5554-35-3 (In Press)

Syamsu, Indah Wahyuni (2018) KEMAMPUAN SISWA DALAM MENGGAMBAR BENTUK DI KELAS XI IPA 1 SMA NEGERI 1 BUA PONRANG KABUPATEN LUWU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

T

TRI PUTRA,, ARDIAN (2018) PENINGKATAN KEMAMPUAN BERMAIN MUSIK ANSAMBEL MELALUI KEGIATAN EKSTRAKURIKULER PADA SISWA DI SMAN 4 BULUKUMBA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

TRI PUTRA,, ARDIAN (2018) PENINGKATAN KEMAMPUAN BERMAIN MUSIK ANSAMBEL MELALUI KEGIATAN EKSTRAKURIKULER PADA SISWA DI SMAN 4 BULUKUMBA. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Taggiling, Nur Alfa (2018) Perancangan Media Pembelajaran Pengenalan Nama Buah dan Hewan Dalam Bahasa Inggris, Bahasa Bugis dan Bahasa Indonesia Bagi Anak Usia Dini. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Tata, Ahmad Rahim (2018) PERANCANGAN MEDIA PROMOSI KAMPUNG TUA BITOMBANG. S1 thesis, Universitas Negeri Makassar.

Tata, Ahmad Rahim (2018) PERANCANGAN MEDIA PROMOSI KAMPUNG TUA BITOMBANG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Tono, Riki Umar (2018) KEMAMPUAN MENGGAMBAR PERSPEKTIF MAHASISWA SENI RUPA ANGKATAN 2017 PADA PRODI PENDIDIKAN SENI RUPA FSD UNM. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

U

Ufriani, Ufriani (2018) PENINGKATAN KEAKTIFAN DAN HASIL BELAJAR SENI TARI SISWA DENGAN MODEL PEMBELAJARAN TUTOR SEBAYA DI KELAS VII A SMP NEGERI 2 LILIRILAU KABUPATEN SOPPENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

UlfaMawaddah, Arini (2018) MENINGKATKANHASILBELAJARMELALUIMODELINKUIRIDALAM PEMBELAJARAN SENITARIPADASISWAKELASVISMPNEGERI2SINJAITENGAH. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Umar, Nurhayati (2018) Perancangan Komik Media Pembelajaran Matematika Bagi Siswa Kelas 2 Sekolah Dasar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Usman, Nurul Taqwa (2018) DIDEQ DALAM UPACARA ADAT A’DINGING-DINGING DI DUSUN TENRO DESA BONTOLEMPANGAN KECAMATAN BUKI KABUPATEN KEPULAUAN SELAYAR. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Utler, Thersila Tasia Fransiska (2018) Design of Tourism Promotion Media in Jayapura District Perancangan Media Promosi Pariwisata di Kabupaten Jayapura. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

W

Wawo, Andi Rifaldi (2018) Pembuatan Buku Cerita Digital Perang Makassar Dengan Metode Set Capture Action Figure. S1 thesis, UNIVERSITAS NEGERI MAKKASAR.

Wawo, Andi Rifaldi (2018) Pembuatan Buku Cerita Digital Perang Makassar Dengan Metode Set Capture Action Figure. S1 thesis, Universitas Negeri Makassar.

Wisjayanti, Wisjayanti (2018) PENERAPAN PENDEKATAN CONTEXTUAL TEACHING AND LEARNING DALAM MENINGKATKAN APRESIASI SISWA DALAM MATA PELAJARAN MUSIK NUSANTARA KELAS XII SMA NEGERI 2 BAUBAU. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Wulandari, Sri (2018) Perancangan Buku Bergambar Cerita Rakyat Karampuang. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Y

Yahya, Syukri (2018) Bentuk Dan Makna Motif Hias Sarung Sutra Mandar di Kecamatan Tinambung Kabupaten Polewali Mandar. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Yani, Muhammad (2018) NILAI PENDIDIKAN DALAM RITUAL MASSUREQ MEONG PALO KARELLA’E PADA UPACARA MADDOJA BINE DI DESA LEWORENG KECAMATAN DONRI-DONRI KABUPATEN SOPPENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Yuliani, Lily (2018) PEMANFATAN LIMBAH KARDUS DALAM PEMBUATAN BENDA PAKAI DI KELAS VIII SMP NEGERI 3 LILIRILAU KABUPATEN SOPPENG. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Yuliarnita, Riri (2018) TARI PATTENNUNG SEBAGAI TARI PENYAMBUTAN TAMU RESMI PEMERINTAH DAERAH DI KABUPATEN WAJO. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Yunus, Pangeran Paita (2018) ANALISIS KETERLAKSANAAN PENILAIAN OTENTIK DALAM PEMBELAJARAN SENI BUDAYA PADA SMP DI KOTA MAKASSAR. Prosiding Seminar Nasional Dies Natalis UNM Ke 57,. ISSN 978-602-5554-35-3 (In Press)

Yusuf, Syamsurijal (2018) STUDI DOKUMENTATIF TENTANG PROSES PEMBUATAN MINIATUR PERAHU SANDEQ DI LITA’ MANDAR KABUPATEN MAJENE SULAWESI BARAT DOCUMENTATIVE STUDY OF THE PROCESS OF MAKING SANDEQ BOAT MINIATURE IN LITA 'MANDAR, MAJENE DISTRICT, SULAWESI BARAT. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Z

ZUBAIR, AHMAD and Pattaufi, and Pangeran, Paita Yunus (2018) Abstract. The study aims at developing graphic print art learning module using carbon paper media to grade IX at SMP/MTs in SMPN 22 in Makassar as the site of the research which meet valid criteria to be applied in graphic arts and modification technique learning module using carbon paper media to grade IX at SMP/MTs in SMPN 22 in makassar consisted of teacher’s manual module and student’s manual module and the product obtained would be stated as valid. The model used in this research and development reffered to 4-D Thiagarajan’s model, which consisted of four stages and simplified to two stages, namely defining stages and design stages. The development stage was merely partly. The development of graphic print art learning module using carbon paper media to grade IX at SMP/MTs in SMPN 22 Makassar was validated by one graphic expert and two material experts. The instrument used to collect the data was questionnaire given to the assesors for graphic and material. Data were analyzed by employing descriptive qualitative data analysis. The data result of learning module were counted beforehand quantitatively; then, it was equivalent to qualitative data. The result of the study reveal that in general the graphic print art learning module using carbon paper media to grade IX at SMP/MTs in SMPN 22 in Makassar which was developed had met vilid criteria; this, it is feasible to be continued in trial test to measure the practicality and effectiveness of the learning module. Nuansa Journal of Arts and Design, 1 (2). pp. 60-69. ISSN 2597-4041

ZULFAHRUDDIN, ZULFAHRUDDIN (2018) Proses Pembuatan Kanda – kanda Wuta pada Suku Tolaki di Konawe Sulawesi Tenggara. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

Zulfina Akmal,, Linah (2018) Drama Dance Performance Samindara on Samindara Festival at Desa Salemba Kecamatan Ujungloie Kabupaten Bulukumba Pertunjukan Dramatari Samindara pada Acara Festival Samindara di Desa Salemba Kecamatan Ujungloe Kabupaten Bulukumba. S1 thesis, UNIVERSITAS NEGERI MAKASSAR.

This list was generated on Tue Feb 18 23:12:37 2020 MSK.